Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Zinc transporter 2 (Slc30a2)

This Recombinant Mouse Zinc transporter 2 (Slc30a2) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Zinc transporter 2, ZnT-2, Solute carrier family 30 member 2

UniProt

Q2HJ10

Expression Region

1-371

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTMDKQNLLESTRGARSFLGSLWKSEASRIPPVDLPAVELAVQSNHYCHAQKDSGSHPD PEKQRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVS SRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGC AVAVNLIMGLALHQSGHGHSHGNSRDDSSQQQNPSVRAAFIHVIGDLLQSVGVLVAAYII YFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVE ALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDM KNCQACQGPLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2E)-Pentene-1,5-diol
TRC-E230315-100MG 100 mg

(2E)-Pentene-1,5-diol

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), 1mg/mL
BNUM2095-50 1x 50 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), 1mg/mL

Sign In for Pricing
View Details
Drebrin 1 (DBN1) (DBN1/2879), CF640R conjugate, 0.1mg/mL
BNC402879-500 1x 500 µL

Drebrin 1 (DBN1) (DBN1/2879), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin 1C (MYO1C) (NM_001080779) Human Over-expression Lysate
LC421110 20 µg

Myosin 1C (MYO1C) (NM_001080779) Human Over-expression Lysate

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Mouse CD274/PD-L1 Antibody[10F.9G2]
E-AB-F1132E-01 50 Tests

APC Anti-Mouse CD274/PD-L1 Antibody[10F.9G2]

Sign In for Pricing
View Details