Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Zinc transporter 2 (Slc30a2)

This Recombinant Mouse Zinc transporter 2 (Slc30a2) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Zinc transporter 2, ZnT-2, Solute carrier family 30 member 2

UniProt

Q2HJ10

Expression Region

1-371

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTMDKQNLLESTRGARSFLGSLWKSEASRIPPVDLPAVELAVQSNHYCHAQKDSGSHPD PEKQRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVS SRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGC AVAVNLIMGLALHQSGHGHSHGNSRDDSSQQQNPSVRAAFIHVIGDLLQSVGVLVAAYII YFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVE ALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDM KNCQACQGPLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGR2 Antibody
KC-8407-01 50 μL

PTGR2 Antibody

Sign In for Pricing
View Details
PTGR2 Antibody
KC-8407-02 100 µL

PTGR2 Antibody

Sign In for Pricing
View Details
PTGR2 Antibody
KC-8407-03 1 mL

PTGR2 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Unknown tissue
CS630667 5x 5 µm

Frozen Tissue Sections, Unknown tissue

Sign In for Pricing
View Details
PFKFB3 (NM_001145443) Human Over-expression Lysate
LC428890 20 µg

PFKFB3 (NM_001145443) Human Over-expression Lysate

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF640R conjugate, 0.1mg/mL
BNC400967-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details