Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide S receptor (Npsr1)

This Recombinant Mouse Neuropeptide S receptor (Npsr1) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Neuropeptide S receptor, G-protein coupled receptor 154, G-protein coupled receptor PGR14

UniProt

Q8BZP8

Expression Region

1-371

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPANLTEGSFHANQTVPMLDSSPVACTEIVTFTEALVAEEWGSFYSSFKTEQLITLWVLF VVTIVGNSVVLFSTCRRKRKSRMTFFVTQLAITDSFTGLINILTDIIWRFTGDFMAPDLV CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQAKVLIGIAWSLSFLFSIP TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLAIISVIYGLVIRTIWMK SKTHETVISNCSDGKLCCSYNRGLISKAKIKAIKYSIVIILAFICCWSPYFLFDILDNFN VLPDTKERFYASVIIQNLPALNSAINPLIYCIFSSSICSPCKMQRSQDSRMTYRERSERH EMQILSKPEFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Poly(A) RNA polymerase, mitochondrial (MTPAP) activation kit by CRISPRa
GA110554 1 Kit

Human Poly(A) RNA polymerase, mitochondrial (MTPAP) activation kit by CRISPRa

Sign In for Pricing
View Details
PARD3 (C-term) Rabbit Polyclonal Antibody
AP18146PU-N 400 µL

PARD3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAGEA9 Human Gene Knockout Kit (CRISPR)
KN401760 1 Kit

MAGEA9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TTC27 (NM_017735) Human Recombinant Protein
TP309016M 100 µg

TTC27 (NM_017735) Human Recombinant Protein

Sign In for Pricing
View Details
Neurofilament (NEFL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G2]
TA801110AM 100 µL

Neurofilament (NEFL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G2]

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF647 conjugate, 0.1mg/mL
BNC470844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details