Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide S receptor (Npsr1)

This Recombinant Mouse Neuropeptide S receptor (Npsr1) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Neuropeptide S receptor, G-protein coupled receptor 154, G-protein coupled receptor PGR14

UniProt

Q8BZP8

Expression Region

1-371

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPANLTEGSFHANQTVPMLDSSPVACTEIVTFTEALVAEEWGSFYSSFKTEQLITLWVLF VVTIVGNSVVLFSTCRRKRKSRMTFFVTQLAITDSFTGLINILTDIIWRFTGDFMAPDLV CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQAKVLIGIAWSLSFLFSIP TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLAIISVIYGLVIRTIWMK SKTHETVISNCSDGKLCCSYNRGLISKAKIKAIKYSIVIILAFICCWSPYFLFDILDNFN VLPDTKERFYASVIIQNLPALNSAINPLIYCIFSSSICSPCKMQRSQDSRMTYRERSERH EMQILSKPEFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS700393 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Phospho-AKT2 (S474) Rabbit Polyclonal Antibody
HA500116 100 µL

Phospho-AKT2 (S474) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF405S conjugate, 0.1mg/mL
BNC042053-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2,3,4,5,6-Hexahydropyrrolo[3,4-c]pyrrole bis Hydrobromide salt
TRC-H109385-5G 5 g

1,2,3,4,5,6-Hexahydropyrrolo[3,4-c]pyrrole bis Hydrobromide salt

Sign In for Pricing
View Details
PBX3 (NM_001134778) Human Over-expression Lysate
LC427493 20 µg

PBX3 (NM_001134778) Human Over-expression Lysate

Sign In for Pricing
View Details
Polr2e (BC026842) Mouse Tagged ORF Clone
MG201273 10 µg

Polr2e (BC026842) Mouse Tagged ORF Clone

Sign In for Pricing
View Details