Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Probable G protein-coupled receptor 85 (gpr85)

This Recombinant Danio rerio Probable G protein-coupled receptor 85 (gpr85) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Probable G protein-coupled receptor 85, Super conserved receptor expressed in brain 2, zSREB2

UniProt

Q9I919

Expression Region

1-371

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANYSHAGDHNILQNVSPLATFLKLTSLGFIIGVGVVGNLLISILLVKDKSLHRAPYYFL LDLCASDILRSAICFPFVFTSVKNGSAWTYGTLTCKVIAFLGVLSCFHTAFMLFCVSVTR YLAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSF RANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVPAVSQNWTFHGPGASGQA AANWLAGFGRGPTPPTLLGIRQNSNAAGRRRLLVLDEFKTEKRISRMFYIITFFFLSLWG PYLVACYWRVFARGPVIPGGYLTAAVWMSFAQAGVNPFICIFSNRELRRCFSTTLLYCRK SRLPREPYCVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-500 1x 500 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-100 1x 100 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-500 1x 500 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF640R conjugate, 0.1mg/mL
BNC401981-100 1x 100 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details