Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Neuropeptide Y receptor type 6 (NPY6R)

This Recombinant Rabbit Neuropeptide Y receptor type 6 (NPY6R) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 6, NPY6-R

UniProt

P79217

Expression Region

1-371

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVSLNDPASNKTSAKSNSSAFFYFESCQSPSLALLLLLIAYTVVLIMGICGNLSLITII FKKQREAQNVTNILIANLSLSDILVCVMCIPFTAIYTLMDRWIFGNTMCKLTSYVQSVSI SVSIFSLVLIAIERYQLIVNPRGWKPSASHAYWGIMLIWLFSLLLSIPLLLSYHLTDEPF RNLSLPTDLYSHHVVCVEHWPSKTNQLLYSTSLIMLQYFVPLGFMFICYLKIVICLHKRN SKIDRRRENESRLTENKRINTMLISIVVTFAACWLPLNTFNVIFDWYHEVLMSCHHDLVF AICHLVAMVSTCINPLFYGFLNRNFQKDLVVLIHHCLCFALRERYENIAISTLHTDESKG SLRVAHIPAGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMRTB1 Human Gene Knockout Kit (CRISPR)
KN418956 1 Kit

DMRTB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
G-CSF Antibody (HRP)
KH-062-01 50 μL

G-CSF Antibody (HRP)

Sign In for Pricing
View Details
G-CSF Antibody (HRP)
KH-062-02 100 µL

G-CSF Antibody (HRP)

Sign In for Pricing
View Details
G-CSF Antibody (HRP)
KH-062-03 1 mL

G-CSF Antibody (HRP)

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS501758 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF740 conjugate, 0.1mg/mL
BNC740489-100 1x 100 µL

Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details