Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galanin receptor type 2 (Galr2)

This Recombinant Mouse Galanin receptor type 2 (Galr2) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Galanin receptor type 2, GAL2-R, GALR-2

UniProt

O88854

Expression Region

1-371

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGSDSQGAEDSSQEGGGGWQPEAVLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTN LFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSL DRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSA PRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRAKRKVTRMIVIV AVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRK GFRKICAGLLRRAPRRASGRVCILAPGNHSGGMLEPESTDLTQVSEAAGPLVPAPALPNC TTLSRTLDPAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Maleimidopropionic acid
C7034-500 500 mg

3-Maleimidopropionic acid

Sign In for Pricing
View Details
Serpinf1 Mouse qPCR Template Standard (NM_011340)
MK200929 1 Kit

Serpinf1 Mouse qPCR Template Standard (NM_011340)

Sign In for Pricing
View Details
TMEM104 Antibody - middle region : HRP (ARP47331_T100-HRP)
ARP47331_T100-HRP 100 µL

TMEM104 Antibody - middle region : HRP (ARP47331_T100-HRP)

Sign In for Pricing
View Details
ADAMTS7 (NT) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-0733R-BF555 100 µL

ADAMTS7 (NT) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
GDN Rabbit Polyclonal Antibody (PerCP)
orb2372572 100 µL

GDN Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) TAF5 Polyclonal Antibody
MBS7142215 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) TAF5 Polyclonal Antibody

Sign In for Pricing
View Details