Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galanin receptor type 2 (Galr2)

This Recombinant Mouse Galanin receptor type 2 (Galr2) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Galanin receptor type 2, GAL2-R, GALR-2

UniProt

O88854

Expression Region

1-371

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGSDSQGAEDSSQEGGGGWQPEAVLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTN LFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSL DRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSA PRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRAKRKVTRMIVIV AVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRK GFRKICAGLLRRAPRRASGRVCILAPGNHSGGMLEPESTDLTQVSEAAGPLVPAPALPNC TTLSRTLDPAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM200A (NM_145111) Human Over-expression Lysate
LS221786 100 µg

FAM200A (NM_145111) Human Over-expression Lysate

Sign In for Pricing
View Details
Potassium Ferrocyanide Purified
1161250 500 500 g

Potassium Ferrocyanide Purified

Sign In for Pricing
View Details
BDE 180 10ug/ml in Iso-octane
BDE18001ZT10 10 mL

BDE 180 10ug/ml in Iso-octane

Sign In for Pricing
View Details
Olfr1317 HDR Plasmid (m)
sc-434589-HDR 20 µg

Olfr1317 HDR Plasmid (m)

Sign In for Pricing
View Details
Rnf38 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4621502 1.0 µg DNA

Rnf38 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Caprisil NH2-D HPLC Column, 3 µm, 100 Å, CX533-AD x 125 mm
CX233-AD 3 µm

Caprisil NH2-D HPLC Column, 3 µm, 100 Å, CX533-AD x 125 mm

Sign In for Pricing
View Details