Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Delta-type opioid receptor (Oprd1)

This Recombinant Rat Delta-type opioid receptor (Oprd1) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Delta-type opioid receptor, D-OR-1, DOR-1, Opioid receptor A

UniProt

P33533

Expression Region

1-372

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC TPSDGPGGGAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsc70 (HSPA8) Human Gene Knockout Kit (CRISPR)
KN202209RB 1 Kit

Hsc70 (HSPA8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HHLA1 (NM_001145095) Human Over-expression Lysate
LY428685 100 µg

HHLA1 (NM_001145095) Human Over-expression Lysate

Sign In for Pricing
View Details
SPINT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]
TA504562BM 100 µL

SPINT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]

Sign In for Pricing
View Details
Deoxynojirimycin Hydrochloride
TRC-D245005-5MG 5 mg

Deoxynojirimycin Hydrochloride

Sign In for Pricing
View Details
CD79a (JCB117), CF568 conjugate, 0.1mg/mL
BNC680476-500 1x 500 µL

CD79a (JCB117), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GATA6 Human Gene Knockout Kit (CRISPR)
KN420721 1 Kit

GATA6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details