Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Delta-type opioid receptor (Oprd1)

This Recombinant Mouse Delta-type opioid receptor (Oprd1) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Delta-type opioid receptor, D-OR-1, DOR-1, K56, MSL-2

UniProt

P32300

Expression Region

1-372

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC TPSDGPGGGAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAP1 (NM_006106) Human Over-expression Lysate
LC401842 20 µg

YAP1 (NM_006106) Human Over-expression Lysate

Sign In for Pricing
View Details
TPSB2 (NM_024164) Human Over-expression Lysate
LC402980 20 µg

TPSB2 (NM_024164) Human Over-expression Lysate

Sign In for Pricing
View Details
CXCR5 Recombinant Rabbit Monoclonal Antibody [JB11-40]
ET7107-74 100 µL

CXCR5 Recombinant Rabbit Monoclonal Antibody [JB11-40]

Sign In for Pricing
View Details
Bag1 Recombinant Rabbit Monoclonal Antibody [JE63-22]
HA721885 100 µL

Bag1 Recombinant Rabbit Monoclonal Antibody [JE63-22]

Sign In for Pricing
View Details
Her2 (ERBB2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12G4]
TA503527AM 100 µL

Her2 (ERBB2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12G4]

Sign In for Pricing
View Details
HPV-18 (Human Papilloma Virus 18) (HPV18/1297), CF488A conjugate, 0.1mg/mL
BNC881297-100 1x 100 µL

HPV-18 (Human Papilloma Virus 18) (HPV18/1297), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details