Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Delta-type opioid receptor (Oprd1)

This Recombinant Mouse Delta-type opioid receptor (Oprd1) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Delta-type opioid receptor, D-OR-1, DOR-1, K56, MSL-2

UniProt

P32300

Expression Region

1-372

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC TPSDGPGGGAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FLT1 Protein (aa 1-756, His Tag)
PKSH031842-01 100 µg

Recombinant Human FLT1 Protein (aa 1-756, His Tag)

Sign In for Pricing
View Details
Recombinant Human FLT1 Protein (aa 1-756, His Tag)
PKSH031842-02 1 mg

Recombinant Human FLT1 Protein (aa 1-756, His Tag)

Sign In for Pricing
View Details
CFTR Recombinant Rabbit monoclonal Antibody
HA723168 100 µL

CFTR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Progesterone Receptor (Ab-294) Antibody
8B0558-AAT 50 µg

Progesterone Receptor (Ab-294) Antibody

Sign In for Pricing
View Details
FerroBrite™ Green
20205-AAT 1 mg

FerroBrite™ Green

Sign In for Pricing
View Details
Caap1 Mouse Gene Knockout Kit (CRISPR)
KN502398 1 Kit

Caap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details