Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Delta-type opioid receptor (Oprd1)

This Recombinant Mouse Delta-type opioid receptor (Oprd1) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Delta-type opioid receptor, D-OR-1, DOR-1, K56, MSL-2

UniProt

P32300

Expression Region

1-372

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC TPSDGPGGGAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI2E8]
CF810861 100 µg

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI2E8]

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (Y508H) (His Tag)
PKSV030413 100 µg

Recombinant SARS-CoV-2 Spike RBD (Y508H) (His Tag)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgG, Fc Specific,  30nm
GAF-311-30 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgG, Fc Specific, 30nm

Sign In for Pricing
View Details
Pts (NM_011220) Mouse Tagged ORF Clone
MG200948 10 µg

Pts (NM_011220) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Chloride Channel 5 (CLCN5) (NM_001272102) Human Tagged ORF Clone
RG235441 10 µg

Chloride Channel 5 (CLCN5) (NM_001272102) Human Tagged ORF Clone

Sign In for Pricing
View Details
Angiotensin Converting Enzyme (ACE1) Activity Assay Kit
E-BC-K003-M-01 48 T (46 samples)

Angiotensin Converting Enzyme (ACE1) Activity Assay Kit

Sign In for Pricing
View Details