Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Neuropeptide S receptor (Npsr1)

This Recombinant Rat Neuropeptide S receptor (Npsr1) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Neuropeptide S receptor, G-protein coupled receptor 154

UniProt

P0C0L6

Expression Region

1-372

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPANLTEGSFHANQTVPMLDSSPVACTEIVTFTEALEAEEWGSFYSSFKTEQLITLWVLF VFTIVGNSVVLFSTWRRKRKSRMTFFVTQLAITDSFTGLINILTDIIWRFTGDFMAPDLV CRIVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGAEKQAKVLIGIAWSLSFLFSI PTLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISVIYGLVIRTIWI KSKAHETVISNCSDGELCCSYNRGLISKAKIKAIKYSIVIILAFICCWSPYFLFDMLDNF NLLPDTKERFYASVIIQNLPALNSAINPLIYCIFSGSLCSPCKVQRSQDSRMTYRERSER HEMQILSKPEFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-100 1x 100 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-100 1x 100 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-500 1x 500 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF740 conjugate, 0.1mg/mL
BNC741492-500 1x 500 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details