Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Galanin receptor type 2 (Galr2)

This Recombinant Rat Galanin receptor type 2 (Galr2) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Galanin receptor type 2, GAL2-R, GALR-2

UniProt

O08726

Expression Region

1-372

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGSGSQGAENTSQEGGSGGWQPEAVLVPLFFALIFLVGTVGNALVLAVLLRGGQAVSTT NLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVS LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYRQSQLANLTVCHPAWS APRRRAMDLCTFVFSYLLPVLVLSLTYARTLRYLWRTVDPVTAGSGSQRAKRKVTRMIII VAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR KGFRKICAGLLRPAPRRASGRVSILAPGNHSGSMLEQESTDLTQVSEAAGPLVPPPALPN CTASSRTLDPAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANBP3 (NM_007322) Human Recombinant Protein
TP314493L 1 mg

RANBP3 (NM_007322) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse CD180/RP105/LY64 Protein (Fc Tag)
PKSM040653 100 µg

Recombinant Mouse CD180/RP105/LY64 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse SLAMF7/CD319 Protein (His Tag)
PKSM041236-01 10 µg

Recombinant Mouse SLAMF7/CD319 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse SLAMF7/CD319 Protein (His Tag)
PKSM041236-02 50 µg

Recombinant Mouse SLAMF7/CD319 Protein (His Tag)

Sign In for Pricing
View Details
Electric gynecological table BHBD-209
BHBD-209 1 Unit

Electric gynecological table BHBD-209

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS645982 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details