Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Galanin receptor type 2 (Galr2)

This Recombinant Rat Galanin receptor type 2 (Galr2) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Galanin receptor type 2, GAL2-R, GALR-2

UniProt

O08726

Expression Region

1-372

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGSGSQGAENTSQEGGSGGWQPEAVLVPLFFALIFLVGTVGNALVLAVLLRGGQAVSTT NLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVS LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYRQSQLANLTVCHPAWS APRRRAMDLCTFVFSYLLPVLVLSLTYARTLRYLWRTVDPVTAGSGSQRAKRKVTRMIII VAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR KGFRKICAGLLRPAPRRASGRVSILAPGNHSGSMLEQESTDLTQVSEAAGPLVPPPALPN CTASSRTLDPAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXLNA Antibody
KC-2127-01 50 μL

TXLNA Antibody

Sign In for Pricing
View Details
TXLNA Antibody
KC-2127-02 100 µL

TXLNA Antibody

Sign In for Pricing
View Details
TXLNA Antibody
KC-2127-03 1 mL

TXLNA Antibody

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), CF594 conjugate, 0.1mg/mL
BNC941395-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RHOA Rabbit Polyclonal Antibody
AP06618PU-N 100 µg

RHOA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fos B (FOSB) Mouse Monoclonal Antibody [Clone ID: OTI6H6]
CF804226 100 µg

Fos B (FOSB) Mouse Monoclonal Antibody [Clone ID: OTI6H6]

Sign In for Pricing
View Details