Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein adipocyte-associated 1 (TPRA1)

This Recombinant Human Transmembrane protein adipocyte-associated 1 (TPRA1) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Transmembrane protein adipocyte-associated 1, Integral membrane protein GPR175

UniProt

Q86W33

Expression Region

1-373

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSRVRYWDLLLLIPNVLFLIF LLWKLPSARAKIRITSSPIFITFYILVFVVALVGIARAVVSMTVSTSNAATVADKILWEI TRFFLLAIELSVIILGLAFGHLESKSSIKRVLAITTVLSLAYSVTQGTLEILYPDAHLSA EDFNIYGHGGRQFWLVSSCFFFLVYSLVVILPKTPLKERISLPSRRSFYVYAGILALLNL LQGLGSVLLCFDIIEGLCCVDATTFLYFSFFAPLIYVAFLRGFFGSEPKILFSYKCQVDE TEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSI NSTDSERWKAINA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Elavl3 / Elavl4 Antibody
RC-5191-01 50 μL

Recombinant Elavl3 / Elavl4 Antibody

Sign In for Pricing
View Details
Recombinant Elavl3 / Elavl4 Antibody
RC-5191-02 100 µL

Recombinant Elavl3 / Elavl4 Antibody

Sign In for Pricing
View Details
Recombinant Elavl3 / Elavl4 Antibody
RC-5191-03 1 mL

Recombinant Elavl3 / Elavl4 Antibody

Sign In for Pricing
View Details
CD284 / TLR4 (TLR4/230), Biotin conjugate, 0.1mg/mL
BNCB0230-100 1x 100 µL

CD284 / TLR4 (TLR4/230), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLEKHG4 (NM_001129727) Human Over-expression Lysate
LC427036 20 µg

PLEKHG4 (NM_001129727) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Muscle tissue
CB505914 1 Block

Frozen Tissue Blocks, Muscle tissue

Sign In for Pricing
View Details