Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein adipocyte-associated 1 (TPRA1)

This Recombinant Human Transmembrane protein adipocyte-associated 1 (TPRA1) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Transmembrane protein adipocyte-associated 1, Integral membrane protein GPR175

UniProt

Q86W33

Expression Region

1-373

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSRVRYWDLLLLIPNVLFLIF LLWKLPSARAKIRITSSPIFITFYILVFVVALVGIARAVVSMTVSTSNAATVADKILWEI TRFFLLAIELSVIILGLAFGHLESKSSIKRVLAITTVLSLAYSVTQGTLEILYPDAHLSA EDFNIYGHGGRQFWLVSSCFFFLVYSLVVILPKTPLKERISLPSRRSFYVYAGILALLNL LQGLGSVLLCFDIIEGLCCVDATTFLYFSFFAPLIYVAFLRGFFGSEPKILFSYKCQVDE TEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSI NSTDSERWKAINA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibroblast Growth Factor 2 (FGF2) Protein
abx657902-01 10 µg

Human Fibroblast Growth Factor 2 (FGF2) Protein

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 2 (FGF2) Protein
abx657902-02 50 µg

Human Fibroblast Growth Factor 2 (FGF2) Protein

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 2 (FGF2) Protein
abx657902-03 100 µg

Human Fibroblast Growth Factor 2 (FGF2) Protein

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 2 (FGF2) Protein
abx657902-04 200 µg

Human Fibroblast Growth Factor 2 (FGF2) Protein

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 2 (FGF2) Protein
abx657902-05 500 µg

Human Fibroblast Growth Factor 2 (FGF2) Protein

Sign In for Pricing
View Details
Donkey Relaxin ELISA Kit
MBS056003 Inquire

Donkey Relaxin ELISA Kit

Sign In for Pricing
View Details