Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein adipocyte-associated 1 (TPRA1)

This Recombinant Human Transmembrane protein adipocyte-associated 1 (TPRA1) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Transmembrane protein adipocyte-associated 1, Integral membrane protein GPR175

UniProt

Q86W33

Expression Region

1-373

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSRVRYWDLLLLIPNVLFLIF LLWKLPSARAKIRITSSPIFITFYILVFVVALVGIARAVVSMTVSTSNAATVADKILWEI TRFFLLAIELSVIILGLAFGHLESKSSIKRVLAITTVLSLAYSVTQGTLEILYPDAHLSA EDFNIYGHGGRQFWLVSSCFFFLVYSLVVILPKTPLKERISLPSRRSFYVYAGILALLNL LQGLGSVLLCFDIIEGLCCVDATTFLYFSFFAPLIYVAFLRGFFGSEPKILFSYKCQVDE TEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSI NSTDSERWKAINA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Insulin Like Growth Factor 1
547730 200 µL

Insulin Like Growth Factor 1

Sign In for Pricing
View Details
FAM181A Recombinant Protein Antigen
NBP1-90730PEP 0.1 mL

FAM181A Recombinant Protein Antigen

Sign In for Pricing
View Details
Mouse Ap2m1 activation kit by CRISPRa
GA200212 1 Kit

Mouse Ap2m1 activation kit by CRISPRa

Sign In for Pricing
View Details
MTIF2 Protein (N-His, Human)
P506256 100 µg

MTIF2 Protein (N-His, Human)

Sign In for Pricing
View Details
Canine Microalbuminuria  (MAU) ELISA Kit
MBS2603204-01 48 Well

Canine Microalbuminuria  (MAU) ELISA Kit

Sign In for Pricing
View Details
Canine Microalbuminuria  (MAU) ELISA Kit
MBS2603204-02 96 Well

Canine Microalbuminuria  (MAU) ELISA Kit

Sign In for Pricing
View Details