Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 45 (Gpr45)

This Recombinant Mouse Probable G-protein coupled receptor 45 (Gpr45) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 45, PSP24-1, PSP24-alpha

UniProt

Q9EQQ4

Expression Region

1-373

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MACNSTPMGTYEHLLLNVSNTLDPGDTPLSAPLRISLAIMMLLMIVVGFLGNTVVCIIVY QRPAMRSAINLLLATLAFSDIMLSLCCMPFTAITLITVRWHFGDHFCRLSATLYWFFVLE GVAILLIISVDRFLIIVQRQDKLNPRRAKMIIAASWVLSFCISAPSFTGWTFMEVPARAP QCVLGYTEFPAERAYVVTLVVAVFFAPFGVMLCSYLCILNTVRKNAVRVHNQSDSLDLRQ LTGAGLRRLRRQQQQASLDLSFKTKAFTTILILFVGFSLCWLPHSVYSLLSAFSRRFYYS ASFYTTSTCVLWLSYLKSVFNPIVYCWRIKKFREACIELLPHTFQILPKVPERIQRKIQP STIYVCNENQSAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike Protein, Biotinylated (RBD, His Tag)
PKSR030501 20 µg

Recombinant SARS-CoV-2 Spike Protein, Biotinylated (RBD, His Tag)

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), CF405S conjugate, 0.1mg/mL
BNC042924-100 1x 100 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS506953 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Human GFY activation kit by CRISPRa
GA119310 1 Kit

Human GFY activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS801883 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Mouse Complement Factor H (CFH) ELISA Kit
RD-CFH-Mu-01 96 Tests

Mouse Complement Factor H (CFH) ELISA Kit

Sign In for Pricing
View Details