Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 45 (Gpr45)

This Recombinant Mouse Probable G-protein coupled receptor 45 (Gpr45) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 45, PSP24-1, PSP24-alpha

UniProt

Q9EQQ4

Expression Region

1-373

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MACNSTPMGTYEHLLLNVSNTLDPGDTPLSAPLRISLAIMMLLMIVVGFLGNTVVCIIVY QRPAMRSAINLLLATLAFSDIMLSLCCMPFTAITLITVRWHFGDHFCRLSATLYWFFVLE GVAILLIISVDRFLIIVQRQDKLNPRRAKMIIAASWVLSFCISAPSFTGWTFMEVPARAP QCVLGYTEFPAERAYVVTLVVAVFFAPFGVMLCSYLCILNTVRKNAVRVHNQSDSLDLRQ LTGAGLRRLRRQQQQASLDLSFKTKAFTTILILFVGFSLCWLPHSVYSLLSAFSRRFYYS ASFYTTSTCVLWLSYLKSVFNPIVYCWRIKKFREACIELLPHTFQILPKVPERIQRKIQP STIYVCNENQSAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEX13 (NM_002618) Human Over-expression Lysate
LY419218 100 µg

PEX13 (NM_002618) Human Over-expression Lysate

Sign In for Pricing
View Details
Retinoic Acid Receptor alpha (RARA) Mouse Monoclonal Antibody [Clone ID: OTI2B4]
CF806351 100 µg

Retinoic Acid Receptor alpha (RARA) Mouse Monoclonal Antibody [Clone ID: OTI2B4]

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799), CF568 conjugate, 0.1mg/mL
BNC680799-100 1x 100 µL

Cytokeratin 19 (KRT19/799), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Boc-(R)-Phenylephrine Sodium Salt
TRC-B661750-5G 5 g

N-Boc-(R)-Phenylephrine Sodium Salt

Sign In for Pricing
View Details
Mouse HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
E-EL-M0687-01 24 Tests

Mouse HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Mouse HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
E-EL-M0687-02 48 Tests

Mouse HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details