Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse P2Y purinoceptor 2 (P2ry2)

This Recombinant Mouse P2Y purinoceptor 2 (P2ry2) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

P2Y purinoceptor 2, P2Y2, ATP receptor, P2U purinoceptor 1, P2U1, Purinergic receptor

UniProt

P35383

Expression Region

1-373

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADLEPWNSTINGTWEGDELGYKCRFNEDFKYVLLPVSYGVVCVLGLCLNVVALYIFLC RLKTWNASTTYMFHLAVSDSLYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTR ITCHDTSARELFSHFVAYSSVMLGLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAK RKSVRTIALVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTEPTPSPQARRKLGLHRPNRTVRKDLSVSSDDSRRTE STPAGSETKDIRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDZRN4 Antibody
KC-2578-01 50 μL

PDZRN4 Antibody

Sign In for Pricing
View Details
PDZRN4 Antibody
KC-2578-02 100 µL

PDZRN4 Antibody

Sign In for Pricing
View Details
PDZRN4 Antibody
KC-2578-03 1 mL

PDZRN4 Antibody

Sign In for Pricing
View Details
MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: OTI2D6]
CF810453 100 µg

MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: OTI2D6]

Sign In for Pricing
View Details
Mix-n-StainTM CF®568 Nanobody Labeling Kit, 1x (20-50ug) labeling
#92507 1 Kit

Mix-n-StainTM CF®568 Nanobody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
Chst15 Mouse Gene Knockout Kit (CRISPR)
KN503325 1 Kit

Chst15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details