Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse P2Y purinoceptor 2 (P2ry2)

This Recombinant Mouse P2Y purinoceptor 2 (P2ry2) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

P2Y purinoceptor 2, P2Y2, ATP receptor, P2U purinoceptor 1, P2U1, Purinergic receptor

UniProt

P35383

Expression Region

1-373

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADLEPWNSTINGTWEGDELGYKCRFNEDFKYVLLPVSYGVVCVLGLCLNVVALYIFLC RLKTWNASTTYMFHLAVSDSLYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLHSLRWGRARYARRVAAVVWVLVLACQAPVLYFVTTSVRGTR ITCHDTSARELFSHFVAYSSVMLGLLFAVPFSVILVCYVLMARRLLKPAYGTTGGLPRAK RKSVRTIALVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTEPTPSPQARRKLGLHRPNRTVRKDLSVSSDDSRRTE STPAGSETKDIRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cartilage
CS806015 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
S100A1 (Melanoma Marker) (S100A1/1942), CF405S conjugate, 0.1mg/mL
BNC041942-100 1x 100 µL

S100A1 (Melanoma Marker) (S100A1/1942), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IMMP2L Human Gene Knockout Kit (CRISPR)
KN415438 1 Kit

IMMP2L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
E74 like factor 1 (ELF1) Mouse Monoclonal Antibody [Clone ID: OTI3D3]
CF811235 100 µg

E74 like factor 1 (ELF1) Mouse Monoclonal Antibody [Clone ID: OTI3D3]

Sign In for Pricing
View Details
Mouse CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit
E-EL-M3065-01 24 Tests

Mouse CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Mouse CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit
E-EL-M3065-02 48 Tests

Mouse CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details