Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat 5-hydroxytryptamine receptor 1D (Htr1d)

This Recombinant Rat 5-hydroxytryptamine receptor 1D (Htr1d) spans the amino acid sequence from region 1-374.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1D, 5-HT-1D, 5-HT1D, Serotonin receptor 1D

UniProt

P28565

Expression Region

1-374

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLPNQSLEGLPQEASNRSLNATGAWDPEVLQALRISLVVVLSIITLATVLSNAFVLTTI LLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCT ASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWAISICISIPPLFWRQATAHE EMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTTAQ LITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTL GIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDF RQAFQRVVHFRKAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phaseolus vulgaris Lectin (PHA-E) - TRITC (Rhodamine)
30330024-1 2 mg

Phaseolus vulgaris Lectin (PHA-E) - TRITC (Rhodamine)

Sign In for Pricing
View Details
MTHFD2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
30888061 1.0 µg DNA

MTHFD2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Solute Carrier Family 44 Member 1 (SLC44A1) Antibody
abx237964 100 µg

Solute Carrier Family 44 Member 1 (SLC44A1) Antibody

Sign In for Pricing
View Details
Recombinant Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle (petC-1)
MBS7025830-01 0.02 mg

Recombinant Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle (petC-1)

Sign In for Pricing
View Details
Recombinant Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle (petC-1)
MBS7025830-02 0.1 mg

Recombinant Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle (petC-1)

Sign In for Pricing
View Details
Recombinant Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle (petC-1)
MBS7025830-03 5x 0.1 mg

Recombinant Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle (petC-1)

Sign In for Pricing
View Details