Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Stage III sporulation protein AE (spoIIIAE)

This Recombinant Bacillus subtilis Stage III sporulation protein AE (spoIIIAE) spans the amino acid sequence from region 25-399.

Product Specifications

Product Name Alternative

Stage III sporulation protein AE

UniProt

P49782

Expression Region

25-399

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGNAEQTEDHAETAEQLAERTAASLETDKIGEFWNDIMTEYGGLLPESQKGSLMEFINGD KSFSPQEWLKALFSYLFHEVLANGKLLGTLILLTIFCVILQLLQNAFQQSTVSKVAYSIV YMVLIILALNSFHVAINYATEAIQTMTSFILALIPLLLALLASSGGAVSAAFFHPVILFL MNTSGLLIQNIVMPLIFLSAILSIVSTMTEQYKVTQLANLLRNIAIGALAVFLTIFLGVI SVQGASAAVTDGITLRTAKFITGNFIPVLGRMFTDATDTVISASLLLKNTVGILGVAILI CIAAFPAIKVLSLAFIYKLAAAILQPLGGGPVITCLDVISKSVIYIFAALAIVSLMFFLS LTVIITAGNLTMMMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details