Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide Y receptor type 4 (Ppyr1)

This Recombinant Mouse Neuropeptide Y receptor type 4 (Ppyr1) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 4, NPY4-R, NPYR-D, Pancreatic polypeptide receptor 1, PP1

UniProt

Q61041

Expression Region

1-375

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTSHFLAPLFPGSLQGKNGTNPLDSPYNFSDGCQDSAELLAFIITTYSIETILGVLGNL CLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFI QCMSVTVSILSLVLVALERHQLIINPTGWKPSIFQAYLGIVVIWFVSCFLSLPFLANSTL NDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCIPLAFILVCYIRIYQR LQRQKHVFHAHACSSRAGQMKRINSMLMTMVTAFAVLWLPLHVFNTLEDWYQEAIPACHG NLIFLMCHLLAMASTCVNPFIYGFLNINFKKDIKALVLTCHCRSPRGESEHLPLSTVHTD LSKGSMRMGSKSNFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant RhoGDI Antibody
RC-15896-01 50 μL

Recombinant RhoGDI Antibody

Sign In for Pricing
View Details
Recombinant RhoGDI Antibody
RC-15896-02 100 µL

Recombinant RhoGDI Antibody

Sign In for Pricing
View Details
Recombinant RhoGDI Antibody
RC-15896-03 1 mL

Recombinant RhoGDI Antibody

Sign In for Pricing
View Details
Human GALNT10 activation kit by CRISPRa
GA110794 1 Kit

Human GALNT10 activation kit by CRISPRa

Sign In for Pricing
View Details
Cd68 Mouse Gene Knockout Kit (CRISPR)
KN502933 1 Kit

Cd68 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FGF21 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B2]
TA502771BM 100 µL

FGF21 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B2]

Sign In for Pricing
View Details