Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide Y receptor type 4 (Ppyr1)

This Recombinant Mouse Neuropeptide Y receptor type 4 (Ppyr1) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 4, NPY4-R, NPYR-D, Pancreatic polypeptide receptor 1, PP1

UniProt

Q61041

Expression Region

1-375

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTSHFLAPLFPGSLQGKNGTNPLDSPYNFSDGCQDSAELLAFIITTYSIETILGVLGNL CLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFI QCMSVTVSILSLVLVALERHQLIINPTGWKPSIFQAYLGIVVIWFVSCFLSLPFLANSTL NDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCIPLAFILVCYIRIYQR LQRQKHVFHAHACSSRAGQMKRINSMLMTMVTAFAVLWLPLHVFNTLEDWYQEAIPACHG NLIFLMCHLLAMASTCVNPFIYGFLNINFKKDIKALVLTCHCRSPRGESEHLPLSTVHTD LSKGSMRMGSKSNFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
E-AB-F0990M-01 50 Tests

Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
E-AB-F0990M-02 100 Tests

Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
E-AB-F0990M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgA1,  5nm
GM-105-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgA1, 5nm

Sign In for Pricing
View Details
Human CXX1 (FAM127A) activation kit by CRISPRa
GA105953 1 Kit

Human CXX1 (FAM127A) activation kit by CRISPRa

Sign In for Pricing
View Details
P57 / KIP2 (KIP2/880), CF594 conjugate, 0.1mg/mL
BNC940880-100 1x 100 µL

P57 / KIP2 (KIP2/880), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details