Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adiponectin receptor protein 1 (Adipor1)

This Recombinant Mouse Adiponectin receptor protein 1 (Adipor1) spans the amino acid sequence from region 1-375aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Progestin and adipoQ receptor family member 1; Progestin and adipoQ receptor family member I

UniProt

Q91VH1

Expression Region

1-375aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.9 kDa

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSPAKAEEDQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hist1h2af (NM_001024282) Rat Tagged Lenti ORF Clone
RR214597L4 10 µg

Hist1h2af (NM_001024282) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GEFT AAV Vector (Human) (CMV)
21435101 1 µg

GEFT AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
4- (2-Phenyl-1H-imidazol-1-yl) butanoic acid hydrochloride
sc-314132 500 mg

4- (2-Phenyl-1H-imidazol-1-yl) butanoic acid hydrochloride

Sign In for Pricing
View Details
Recombinant DENV-1 NS3 Protein, N-His
orb3151627-01 50 µg

Recombinant DENV-1 NS3 Protein, N-His

Sign In for Pricing
View Details
Recombinant DENV-1 NS3 Protein, N-His
orb3151627-02 100 µg

Recombinant DENV-1 NS3 Protein, N-His

Sign In for Pricing
View Details
Recombinant DENV-1 NS3 Protein, N-His
orb3151627-03 1 mg

Recombinant DENV-1 NS3 Protein, N-His

Sign In for Pricing
View Details