Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 34 (Gpr34)

This Recombinant Mouse Probable G-protein coupled receptor 34 (Gpr34) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 34

UniProt

Q9R1K6

Expression Region

1-375

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTSVDSWLCSSHGMHFITNYSDQASQNFSGVPNVTSCPMDEKLLSTVLTTFYSVIFLV GLVGNIIALYVFLGIHRKRNSIQIYLLNVAVADLLLIFCLPFRIMYHINQNKWTLGVILC KVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRRAITTKQSIYVCCIVWTVALAGFL TMIILTLKKGGHNSTMCFHYRDRHNAKGEAIFNFVLVVMFWLIFLLIILSYIKIGKNLLR ISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIIHK TNEIMLVFSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQSEASRSESTSEFKPGHSLHD LSVTVKMPQYSTKGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM70 Rabbit Polyclonal Antibody
orb631982-01 50 µg

TMEM70 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM70 Rabbit Polyclonal Antibody
orb631982-02 100 µg

TMEM70 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPR182 Rabbit Polyclonal Antibody
TA376734 100 µL

GPR182 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
F157C Rabbit Polyclonal Antibody
JOT-AP02512-01 20 µL

F157C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
F157C Rabbit Polyclonal Antibody
JOT-AP02512-02 50 μL

F157C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
F157C Rabbit Polyclonal Antibody
JOT-AP02512-03 100 µL

F157C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details