Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 27 (GPR27)

This Recombinant Human Probable G-protein coupled receptor 27 (GPR27) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 27, Super conserved receptor expressed in brain 1

UniProt

Q9NS67

Expression Region

1-375

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLLLDL CLADGLRALACLPAVMLAARRAAAAAGAPPGALGCKLLAFLAALFCFHAAFLLLGVGVTR YLAIAHHRFYAERLAGWPCAAMLVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGA PGALGFLLLLAVVVGATHLVYLRLLFFIHDRRKMRPARLVPAVSHDWTFHGPGATGQAAA NWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEKRLCKMFYAVTLLFLLLWGPY VVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFRAQFPCCQSPR TTQATHPCDLKGIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRC3 Rabbit Polyclonal Antibody
ER1706-45 100 µL

NLRC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRITC Conjugated Phytolacca americana Lectin (Pokeweed) -PWMPWA-
R-1901-2 2 mg

TRITC Conjugated Phytolacca americana Lectin (Pokeweed) -PWMPWA-

Sign In for Pricing
View Details
Ɑ-Biotinamido-ω-Pyridyldithiopropanamido PEG
1310000-44-25.500MG 500 mg

Ɑ-Biotinamido-ω-Pyridyldithiopropanamido PEG

Sign In for Pricing
View Details
Desmoplakin (DSP) (1672 -1684) Goat Polyclonal Antibody
AP31969PU-N 100 µg

Desmoplakin (DSP) (1672 -1684) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Cdc42se2 Mouse Gene Knockout Kit (CRISPR)
KN502983 1 Kit

Cdc42se2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytochrome p450 (M12P4H2), CF640R conjugate, 0.1mg/mL
BNC402199-500 1x 500 µL

Cytochrome p450 (M12P4H2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details