Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuropeptide Y receptor type 4 (PPYR1)

This Recombinant Human Neuropeptide Y receptor type 4 (PPYR1) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 4, NPY4-R, Pancreatic polypeptide receptor 1, PP1

UniProt

P50391

Expression Region

1-375

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNL CLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFI QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSIL ENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRR LQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHG NLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTE VSKGSLRLSGRSNPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-Rabbit IgG Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG26F-aR 10x 96 Well Plates

Goat anti-Rabbit IgG Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504257 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
EAAC1 Antibody: RPE
SMC-406D-RPE 100 µg

EAAC1 Antibody: RPE

Sign In for Pricing
View Details
Analytical Balance BBAL-107
BBAL-107 1 Unit

Analytical Balance BBAL-107

Sign In for Pricing
View Details
PCARE Antibody
KC-2807-01 50 μL

PCARE Antibody

Sign In for Pricing
View Details
PCARE Antibody
KC-2807-02 100 µL

PCARE Antibody

Sign In for Pricing
View Details