Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuropeptide Y receptor type 4 (PPYR1)

This Recombinant Human Neuropeptide Y receptor type 4 (PPYR1) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 4, NPY4-R, Pancreatic polypeptide receptor 1, PP1

UniProt

P50391

Expression Region

1-375

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNL CLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFI QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSIL ENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRR LQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHG NLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTE VSKGSLRLSGRSNPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Leucine-rich repeat-containing protein 55 (LRRC55) ELISA Kit
abx531434 96 Tests

Human Leucine-rich repeat-containing protein 55 (LRRC55) ELISA Kit

Sign In for Pricing
View Details
ETS2 Mouse Monoclonal Antibody [Clone ID: OTI2A3]
TA505391 100 µL

ETS2 Mouse Monoclonal Antibody [Clone ID: OTI2A3]

Sign In for Pricing
View Details
MRAP Protein Lysate (Rat) with C-HA Tag
30384036 100 µg

MRAP Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Human KLK6 knockout cell line
ABC-KH8021 1 Vial

Human KLK6 knockout cell line

Sign In for Pricing
View Details
Monkey Cyclic nucleotide gated cation channel Alpha 3 (CNGA3) ELISA kit
GTR10425508 96 Well

Monkey Cyclic nucleotide gated cation channel Alpha 3 (CNGA3) ELISA kit

Sign In for Pricing
View Details
ODC1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
32439126 3x 1.0µg DNA

ODC1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details