Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig 5-hydroxytryptamine receptor 1D (HTR1D)

This Recombinant Guinea pig 5-hydroxytryptamine receptor 1D (HTR1D) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1D, 5-HT-1D, 5-HT1D, Serotonin receptor 1D

UniProt

Q60484

Expression Region

1-376

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPPNQSEEGLPQEASNRSLNATETPGDWDPGLLQALKVSLVVVLSIITLATVLSNAFVL TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDIT CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAGAMIAAVWVISICISIPPLFWRQAQ AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYSRIYRAARSRILNPPSLSGKRFT TAHLITGSAGSSLCSLNPSLHEGHMHPGSPLFFNHVRIKLADSVLERKRISAARERKATK TLGIILGAFIVCWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNE DFRQAFQKVVHFRKAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RO60 (NM_001173524) Human Tagged ORF Clone
RC230246 10 µg

RO60 (NM_001173524) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse CD200R4 Protein, Fc Tag
MOP1577 20 µg

Mouse CD200R4 Protein, Fc Tag

Sign In for Pricing
View Details
Mouse Transcription factor IIIB 50 kDa subunit, Brf2 ELISA KIT
ELI-25331m 96 Tests

Mouse Transcription factor IIIB 50 kDa subunit, Brf2 ELISA KIT

Sign In for Pricing
View Details
1-100 μl PCR Grade 50 x 96 Tips Filter Tips
23-0101S 1–100 μL (50 x 96 Filter Tips)

1-100 μl PCR Grade 50 x 96 Tips Filter Tips

Sign In for Pricing
View Details
IGFBP3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-22862R-BF488 100 µL

IGFBP3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
GLPA Polyclonal Conjugated Antibody
orb1618166 100 µL

GLPA Polyclonal Conjugated Antibody

Sign In for Pricing
View Details