Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sphodromantis sp. Rhodopsin

This Recombinant Sphodromantis sp. Rhodopsin spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Rhodopsin, Opsin

UniProt

P35362

Expression Region

1-376

Origin

Sphodromantis sp. (Mantis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLINEPSYSAYSWGGQGGYGNQTVVDKVLPEMLHLIDPHWYQFPPMNPLWHGLLGFVIG CLGFVSVVGNGMVIYIFSTTKGLRTPSNLLVVNLAFSDFLMMLSMSPPMVINCYYETWVL GPFMCELYALLGSLFGCGSIWTMVMIALDRYNVIVKGLAAKPMTNKTAMLRILGIWAMSI AWTVFPLFGWNRYVPEGNMTACGTDYLNKEWVSRSYILVYSVFVYFLPLATIIYSYWFIV QAVSAHEKQMREQAKKMNVASLRSAENANTSAECKLAKVALMTISLWFFAWTPYLVTDFS GIFEWGKISPLATIWCSLFAKANAVYNPIVYGISHPKYRAALNKKFPSLACASEPDDTAS QASGATTVSDEKSASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A H5N1 (A/Cambodia/R0405050/2007) Hemagglutinin Protein (HA1 Subunit) (His Tag)
E45O54553M2-100 100 µg

Influenza A H5N1 (A/Cambodia/R0405050/2007) Hemagglutinin Protein (HA1 Subunit) (His Tag)

Sign In for Pricing
View Details
DIEXF Recombinant Protein (Rat)
RP198053 100 µg

DIEXF Recombinant Protein (Rat)

Sign In for Pricing
View Details
ASGPR1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-4119R-BF488 100 µL

ASGPR1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
GIPC (GIPC1) (NM_202468) Human Recombinant Protein
TP324373L 1 mg

GIPC (GIPC1) (NM_202468) Human Recombinant Protein

Sign In for Pricing
View Details
Aquaporin 5 Polyclonal Antibody FITC Conjugated
MBS9462568-01 0.1 mL

Aquaporin 5 Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details
Aquaporin 5 Polyclonal Antibody FITC Conjugated
MBS9462568-02 5x 0.1 mL

Aquaporin 5 Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details