Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sphodromantis sp. Rhodopsin

This Recombinant Sphodromantis sp. Rhodopsin spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Rhodopsin, Opsin

UniProt

P35362

Expression Region

1-376

Origin

Sphodromantis sp. (Mantis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLINEPSYSAYSWGGQGGYGNQTVVDKVLPEMLHLIDPHWYQFPPMNPLWHGLLGFVIG CLGFVSVVGNGMVIYIFSTTKGLRTPSNLLVVNLAFSDFLMMLSMSPPMVINCYYETWVL GPFMCELYALLGSLFGCGSIWTMVMIALDRYNVIVKGLAAKPMTNKTAMLRILGIWAMSI AWTVFPLFGWNRYVPEGNMTACGTDYLNKEWVSRSYILVYSVFVYFLPLATIIYSYWFIV QAVSAHEKQMREQAKKMNVASLRSAENANTSAECKLAKVALMTISLWFFAWTPYLVTDFS GIFEWGKISPLATIWCSLFAKANAVYNPIVYGISHPKYRAALNKKFPSLACASEPDDTAS QASGATTVSDEKSASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 2, IL-2 ELISA Kit
NB-E10144-01 96 Well

Human Interleukin 2, IL-2 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 2, IL-2 ELISA Kit
NB-E10144-02 96 Well

Human Interleukin 2, IL-2 ELISA Kit

Sign In for Pricing
View Details
GENLISA™ Human Superoxide Dismutase Copper Chaperone ELISA (Superoxide Dismutase Copper Chaperone) ELISA
KBH20461 96 Well

GENLISA™ Human Superoxide Dismutase Copper Chaperone ELISA (Superoxide Dismutase Copper Chaperone) ELISA

Sign In for Pricing
View Details
Recombinant Human FGA Protein, N-His
bs-100406P-01 20 µg

Recombinant Human FGA Protein, N-His

Sign In for Pricing
View Details
Recombinant Human FGA Protein, N-His
bs-100406P-02 50 µg

Recombinant Human FGA Protein, N-His

Sign In for Pricing
View Details
CNR1 Antibody
orb1249274 0.1 mg

CNR1 Antibody

Sign In for Pricing
View Details