Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Procambarus clarkii Rhodopsin (RHO)

This Recombinant Procambarus clarkii Rhodopsin (RHO) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P35356

Expression Region

1-376

Origin

Procambarus clarkii (Red swamp crayfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSWSNQPAMDDYGLPSSNPYGNFTVVDMAPKDILHMIHPHWYQYPPMNPMMYPLLLIFM LFTGILCLAGNFVTIWVFMNTKSLRTPANLLVVNLAMSDFLMMFTMFPPMMVTCYYHTWT LGPTFCQVYAFLGNLCGCASIWTMVFITFDRYNVIVKGVAGEPLSTKKASLWILTIWVLS ITWCIAPFFGWNRYVPEGNLTGCGTDYLSEDILSRSYLYDYSTWVYYLPLLPIYCYVSII KAVAAHEKGMRDQAKKMGIKSLRNEEAQKTSAECRLAKIAMTTVALWFIAWTPYLLINWV GMFARSYLSPVYTIWGYVFAKANAVYNPIVYAISHPKYRAAMEKKLPCLSCKTESDDVSE SASTTTSSAEEKAESA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Lysozyme C, LYZ ELISA Kit
MBS706998-01 24 Well (LIMIT 1)

Rat Lysozyme C, LYZ ELISA Kit

Sign In for Pricing
View Details
Rat Lysozyme C, LYZ ELISA Kit
MBS706998-02 48 Well

Rat Lysozyme C, LYZ ELISA Kit

Sign In for Pricing
View Details
Rat Lysozyme C, LYZ ELISA Kit
MBS706998-03 96 Well

Rat Lysozyme C, LYZ ELISA Kit

Sign In for Pricing
View Details
Rat Lysozyme C, LYZ ELISA Kit
MBS706998-04 5x 96 Well

Rat Lysozyme C, LYZ ELISA Kit

Sign In for Pricing
View Details
Rat Lysozyme C, LYZ ELISA Kit
MBS706998-05 10x 96 Well

Rat Lysozyme C, LYZ ELISA Kit

Sign In for Pricing
View Details
Lentiviral human GRHL3 shRNA (UAS) - Lentiviral human GRHL3 shRNA (UAS, GFP) (25)
GTR15330515 1 Vial

Lentiviral human GRHL3 shRNA (UAS) - Lentiviral human GRHL3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details