Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Limulus polyphemus Lateral eye opsin

This Recombinant Limulus polyphemus Lateral eye opsin spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Lateral eye opsin

UniProt

P35360

Expression Region

1-376

Origin

Limulus polyphemus (Atlantic horseshoe crab)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANQLSYSSLGWPYQPNASVVDTMPKEMLYMIHEHWYAFPPMNPLWYSILGVAMIILGII CVLGNGMVIYLMMTTKSLRTPTNLLVVNLAFSDFCMMAFMMPTMTSNCFAETWILGPFMC EVYGMAGSLFGCASIWSMVMITLDRYNVIVRGMAAAPLTHKKATLLLLFVWIWSGGWTIL PFFGWSRYVPEGNLTSCTVDYLTKDWSSASYVVIYGLAVYFLPLITMIYCYFFIVHAVAE HEKQLREQAKKMNVASLRANADQQKQSAECRLAKVAMMTVGLWFMAWTPYLIISWAGVFS SGTRLTPLATIWGSVFAKANSCYNPIVYGISHPRYKAALYQRFPSLACGSGESGSDVKSE ASATTTMEEKPKIPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV696634 1.0 µg DNA

WT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Goat Anti-Human IgG+IgM+IgA - AF555
BS21640-01 100 µL

Goat Anti-Human IgG+IgM+IgA - AF555

Sign In for Pricing
View Details
Goat Anti-Human IgG+IgM+IgA - AF555
BS21640-02 500 µL

Goat Anti-Human IgG+IgM+IgA - AF555

Sign In for Pricing
View Details
Rabbit Polyclonal ULBP-2 Antibody [DyLight 680]
NBP2-99939FR 0.1 mL

Rabbit Polyclonal ULBP-2 Antibody [DyLight 680]

Sign In for Pricing
View Details
MM.1R/STAT3 Reporter (Luc) stable cell line
GTR15423345 1 Vial

MM.1R/STAT3 Reporter (Luc) stable cell line

Sign In for Pricing
View Details
Rat Neurogulin Elisa Kit
EK720453 96 Well

Rat Neurogulin Elisa Kit

Sign In for Pricing
View Details