Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Limulus polyphemus Lateral eye opsin

This Recombinant Limulus polyphemus Lateral eye opsin spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Lateral eye opsin

UniProt

P35360

Expression Region

1-376

Origin

Limulus polyphemus (Atlantic horseshoe crab)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANQLSYSSLGWPYQPNASVVDTMPKEMLYMIHEHWYAFPPMNPLWYSILGVAMIILGII CVLGNGMVIYLMMTTKSLRTPTNLLVVNLAFSDFCMMAFMMPTMTSNCFAETWILGPFMC EVYGMAGSLFGCASIWSMVMITLDRYNVIVRGMAAAPLTHKKATLLLLFVWIWSGGWTIL PFFGWSRYVPEGNLTSCTVDYLTKDWSSASYVVIYGLAVYFLPLITMIYCYFFIVHAVAE HEKQLREQAKKMNVASLRANADQQKQSAECRLAKVAMMTVGLWFMAWTPYLIISWAGVFS SGTRLTPLATIWGSVFAKANSCYNPIVYGISHPRYKAALYQRFPSLACGSGESGSDVKSE ASATTTMEEKPKIPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF286A Polyclonal Antibody
MBS9134418-01 0.02 mL

ZNF286A Polyclonal Antibody

Sign In for Pricing
View Details
ZNF286A Polyclonal Antibody
MBS9134418-02 0.1 mL

ZNF286A Polyclonal Antibody

Sign In for Pricing
View Details
ZNF286A Polyclonal Antibody
MBS9134418-03 5x 0.1 mL

ZNF286A Polyclonal Antibody

Sign In for Pricing
View Details
HLA-B (JOAN-1), CF640R conjugate, 0.1mg/mL
BNC401005-500 1x 500 µL

HLA-B (JOAN-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRITC Anti-rabbit/ ferret/ cow/ human CD88 Antibody *S5/1*
108801J0-AAT 100 Tests

TRITC Anti-rabbit/ ferret/ cow/ human CD88 Antibody *S5/1*

Sign In for Pricing
View Details
TMEM43 Recombinant Antibody, Biotin Conjugated
bsm-62738R-Biotin 100 µL

TMEM43 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details