Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane transport permease ybhS (ybhS)

This Recombinant Inner membrane transport permease ybhS (ybhS) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Inner membrane transport permease ybhS

UniProt

P0AFQ4

Expression Region

1-377

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNPILSWRRVRALCVKETRQIVRDPSSWLIAVVIPLLLLFIFGYGINLDSSKLRVGILL EQRSEAALDFTHTMTGSPYIDATISDNRQELIAKMQAGKIRGLVVIPVDFAEQMERANAT APIQVITDGSEPNTANFVQGYVEGIWQIWQMQRAEDNGQTFEPLIDVQTRYWFNPAAISQ HFIIPGAVTIIMTVIGAILTSLVVAREWERGTMEALLSTEITRTELLLCKLIPYYFLGML AMLLCMLVSVFILGVPYRGSLLILFFISSLFLLSTLGMGLLISTITRNQFNAAQVALNAA FLPSIMLSGFIFQIDSMPAVIRAVTYIIPARYFVSTLQSLFLAGNIPVVLVVNVLFLIAS AVMFIGLTWLKTKRRLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-500 1x 500 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UACA / Nucling (UACA/1222), CF405S conjugate, 0.1mg/mL
BNC041222-500 1x 500 µL

UACA / Nucling (UACA/1222), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF640R conjugate, 0.1mg/mL
BNC402341-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details