Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oreochromis niloticus G-protein coupled receptor 54 (gpr54)

This Recombinant Oreochromis niloticus G-protein coupled receptor 54 (gpr54) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

G-protein coupled receptor 54

UniProt

Q6BD04

Expression Region

1-377

Origin

Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSSEELWNSTEQVWINGSGTNFSLGRHEDDEEEEGDKHPFFTDAWLVPLFFSLIMLVGL VGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLVCCVPFTATLYPLPGWIFGNFMCKF VAFLQQVTVQATCITLTAMSGDRCYVTVYPLKSLRHRTPKVAMIVSICIWIGSFVLSTPI LMYQRIEEGYWYGPRQYCMERFPSKTHERAFILYQFIAAYLLPVLTISFCYTLMVKRVGQ PTVEPVDNNYQVNLLSERTISIRSKVSKMVVVIVLLFAICWGPIQIFVLFQSFYPNYQPN YATYKIKTWANCMSYANSSVNPIVYGFMGASFQKSFRKTFPFLFKHKVRDSSMASRTANA EIKFVAAEEGNNNNAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-500 1x 500 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (hCGb/459), CF568 conjugate, 0.1mg/mL
BNC680211-100 1x 100 µL

HCG-beta (hCGb/459), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF568 conjugate, 0.1mg/mL
BNC682904-100 1x 100 µL

WIPI2 (2A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF594 conjugate, 0.1mg/mL
BNC941556-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details