Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI, Mouse (HEK293, C-His)

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa) . In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

TFPI Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi-protein-mouse-hek293-c-his.html

Purity

95.00

Smiles

LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK

Molecular Formula

21788 (Gene_ID) O54819-1 (L29-K289) (Accession)

Molecular Weight

Approximately 42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pECMV-Tap1-m-FLAG Plasmid
PVT15083 2 µg

pECMV-Tap1-m-FLAG Plasmid

Sign In for Pricing
View Details
pECMV-Ptprm-m-FLAG Plasmid
PVT15074 2 µg

pECMV-Ptprm-m-FLAG Plasmid

Sign In for Pricing
View Details
Goose Basonuclin 2 (BNC2) ELISA Kit
MBS9906548 Inquire

Goose Basonuclin 2 (BNC2) ELISA Kit

Sign In for Pricing
View Details
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
RDR-SCARB1-Hu-96Tests 96 Tests

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

Sign In for Pricing
View Details
P2rx6 (NM_011028) Mouse Tagged Lenti ORF Clone
MR224683L3 10 µg

P2rx6 (NM_011028) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olr712 Protein Vector (Rat) (pPM-C-HA)
PV290900 500 ng

Olr712 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details