Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI, Mouse (HEK293, C-His)

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa) . In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

TFPI Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi-protein-mouse-hek293-c-his.html

Purity

95.00

Smiles

LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK

Molecular Formula

21788 (Gene_ID) O54819-1 (L29-K289) (Accession)

Molecular Weight

Approximately 42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse IL-10, Antibody
GWB-6121CF 0.5 mg

Rat Anti-Mouse IL-10, Antibody

Sign In for Pricing
View Details
Mouse Trp53inp2 qPCR Primer Pair
QM36634S 200 Tests

Mouse Trp53inp2 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Monoclonal Neprilysin/CD10 Antibody (CB-CALLA) [Alexa Fluor 594]
NBP2-47961AF594 0.1 mL

Mouse Monoclonal Neprilysin/CD10 Antibody (CB-CALLA) [Alexa Fluor 594]

Sign In for Pricing
View Details
Human SAKL (Soluble alpha-Klotho) ELISA Kit
MBS7606772-01 48 Well

Human SAKL (Soluble alpha-Klotho) ELISA Kit

Sign In for Pricing
View Details
Human SAKL (Soluble alpha-Klotho) ELISA Kit
MBS7606772-02 96 Well

Human SAKL (Soluble alpha-Klotho) ELISA Kit

Sign In for Pricing
View Details
Human SAKL (Soluble alpha-Klotho) ELISA Kit
MBS7606772-03 5x 96 Well

Human SAKL (Soluble alpha-Klotho) ELISA Kit

Sign In for Pricing
View Details