Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI, Mouse (HEK293, C-His)

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa) . In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

TFPI Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi-protein-mouse-hek293-c-his.html

Purity

95.00

Smiles

LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK

Molecular Formula

21788 (Gene_ID) O54819-1 (L29-K289) (Accession)

Molecular Weight

Approximately 42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OTP knockout cell line
ABC-KH10982 1 Vial

Human OTP knockout cell line

Sign In for Pricing
View Details
TRNAR31P AAV siRNA Pooled Vector
48354161 1.0 µg

TRNAR31P AAV siRNA Pooled Vector

Sign In for Pricing
View Details
PRRC2A (NM_004638) Human Tagged ORF Clone
RG235365 10 µg

PRRC2A (NM_004638) Human Tagged ORF Clone

Sign In for Pricing
View Details
RBM8 CRISPR Activation Plasmid (m2)
sc-425618-ACT-2 20 µg

RBM8 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 29 (IL29)
MBS2134577-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Interleukin 29 (IL29)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 29 (IL29)
MBS2134577-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Interleukin 29 (IL29)

Sign In for Pricing
View Details