Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P2Y purinoceptor 2 (P2RY2)

This Recombinant Human P2Y purinoceptor 2 (P2RY2) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

P2Y purinoceptor 2, P2Y2, ATP receptor, P2U purinoceptor 1, P2U1, Purinergic receptor

UniProt

P41231

Expression Region

1-377

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR RTESTPAGSENTKDIRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nell2 (NM_001289653) Mouse Untagged Clone
MC228996 10 µg

Nell2 (NM_001289653) Mouse Untagged Clone

Sign In for Pricing
View Details
Mutant p53 Rabbit mAb
E2R380701 100 µL

Mutant p53 Rabbit mAb

Sign In for Pricing
View Details
F2rl1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4354104 1.0 µg DNA

F2rl1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
NIK Antibody
MBS5311213-01 0.1 mg

NIK Antibody

Sign In for Pricing
View Details
NIK Antibody
MBS5311213-02 5x 0.1 mg

NIK Antibody

Sign In for Pricing
View Details
PRKDC Polyclonal Antibody
MBS2540748-01 0.06 mL

PRKDC Polyclonal Antibody

Sign In for Pricing
View Details