Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit 5-hydroxytryptamine receptor 1D (HTR1D)

This Recombinant Rabbit 5-hydroxytryptamine receptor 1D (HTR1D) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1D, 5-HT-1D, 5-HT1D, 5-HT-1D-alpha, Serotonin receptor 1D

UniProt

P49145

Expression Region

1-377

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPSNQSAEGLPQEAANRSLNATGTPEAWDPGTLQALKISLAVVLSIITVATVLSNTFVL TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQVLCDIWVSSDIT CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAVVWAISICISIPPLFWRQAK AHEEVSDCLVNTSQISYTIYSTCGAFYIPSVLLIVLYGRIYMAARNRILNPPSLYGKRFT TAHLITGSAGSSLCSLSPSLGEGHSHSAGSPLFFNPVRIKLADSVLERKRISAARERKAT KTLGIILGAFIGCWLPFFVASLVLPICRDSCWMPPGLFDFFTWLGYLNSLINPIIYTVFN EDFRQAFQRVIHFRKAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Protein flightless-1 homolog/FLII Recombinant Antibody (SAA2243)
HC469013-01 50 µg

Anti-Protein flightless-1 homolog/FLII Recombinant Antibody (SAA2243)

Sign In for Pricing
View Details
Anti-Protein flightless-1 homolog/FLII Recombinant Antibody (SAA2243)
HC469013-02 100 µg

Anti-Protein flightless-1 homolog/FLII Recombinant Antibody (SAA2243)

Sign In for Pricing
View Details
Anti-Protein flightless-1 homolog/FLII Recombinant Antibody (SAA2243)
HC469013-03 1 mg

Anti-Protein flightless-1 homolog/FLII Recombinant Antibody (SAA2243)

Sign In for Pricing
View Details
Anti-STARD8 Antibody
MBS8325306-01 0.03 mL

Anti-STARD8 Antibody

Sign In for Pricing
View Details
Anti-STARD8 Antibody
MBS8325306-02 0.05 mL

Anti-STARD8 Antibody

Sign In for Pricing
View Details
Anti-STARD8 Antibody
MBS8325306-03 0.1 mL

Anti-STARD8 Antibody

Sign In for Pricing
View Details