Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit 5-hydroxytryptamine receptor 1D (HTR1D)

This Recombinant Rabbit 5-hydroxytryptamine receptor 1D (HTR1D) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1D, 5-HT-1D, 5-HT1D, 5-HT-1D-alpha, Serotonin receptor 1D

UniProt

P49145

Expression Region

1-377

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPSNQSAEGLPQEAANRSLNATGTPEAWDPGTLQALKISLAVVLSIITVATVLSNTFVL TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQVLCDIWVSSDIT CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAVVWAISICISIPPLFWRQAK AHEEVSDCLVNTSQISYTIYSTCGAFYIPSVLLIVLYGRIYMAARNRILNPPSLYGKRFT TAHLITGSAGSSLCSLSPSLGEGHSHSAGSPLFFNPVRIKLADSVLERKRISAARERKAT KTLGIILGAFIGCWLPFFVASLVLPICRDSCWMPPGLFDFFTWLGYLNSLINPIIYTVFN EDFRQAFQRVIHFRKAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Microtubule-associated protein tau/MAPT Protein
MBS9146684-01 0.01 mg

Recombinant Human Microtubule-associated protein tau/MAPT Protein

Sign In for Pricing
View Details
Recombinant Human Microtubule-associated protein tau/MAPT Protein
MBS9146684-02 0.02 mg

Recombinant Human Microtubule-associated protein tau/MAPT Protein

Sign In for Pricing
View Details
Recombinant Human Microtubule-associated protein tau/MAPT Protein
MBS9146684-03 0.05 mg

Recombinant Human Microtubule-associated protein tau/MAPT Protein

Sign In for Pricing
View Details
Recombinant Human Microtubule-associated protein tau/MAPT Protein
MBS9146684-04 0.1 mg

Recombinant Human Microtubule-associated protein tau/MAPT Protein

Sign In for Pricing
View Details
Recombinant Human Microtubule-associated protein tau/MAPT Protein
MBS9146684-05 5x 0.1 mg

Recombinant Human Microtubule-associated protein tau/MAPT Protein

Sign In for Pricing
View Details
Fpr-rs6 3'UTR Luciferase Stable Cell Line
TU106720 1.0 mL

Fpr-rs6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details