Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anopheles gambiae Odorant receptor Or2 (OR2)

This Recombinant Anopheles gambiae Odorant receptor Or2 (OR2) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Odorant receptor Or2, AgOr2

UniProt

Q8WTE6

Expression Region

1-378

Origin

Anopheles gambiae (African malaria mosquito)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIEECPIIGVNVRVWLFWSYLRRPRLSRFLVGCIPVAVLNVFQFLKLYSSWGDMSELII NGYFTVLYFNLVLRTSFLVINRRKFETFFEGVAAEYALLEKNDDIRPVLERYTRRGRMLS ISNLWLGAFISACFVTYPLFVPGRGLPYGVTIPGVDVLATPTYQVVFVLQVYLTFPACCM YIPFTSFYATCTLFALVQIAALKQRLGRLGRHSGTMASTGHSAGTLFAELKECLKYHKQI IQYVHDLNSLVTHLCLLEFLSFGMMLCALLFLLSISNQLAQMIMIGSYIFMILSQMFAFY WHANEVLEQSLGIGDAIYNGAWPDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTLEMFQ KLLNVSYSYFTLLRRVYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-100 1x 100 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF740 conjugate, 0.1mg/mL
BNC742278-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF740 conjugate, 0.1mg/mL
BNC742968-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details