Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Chemokine-binding protein 2 (Ccbp2)

This Recombinant Mouse Chemokine-binding protein 2 (Ccbp2) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Chemokine-binding protein 2, C-C chemokine receptor D6, Chemokine-binding protein D6

UniProt

O08707

Expression Region

1-378

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTVASPLPLTTVGSENSSSIYDYDYLDDMTILVCRKDEVLSFGRVFLPVVYSLIFVLGL AGNLLLLVVLLHSAPRRRTMELYLLNLAVSNLLFVVTMPFWAISVAWHWVFGSFLCKVIS TLYSINFYCGIFFITCMSLDKYLEIVHAQPLHRPKAQFRNLLLIVMVWITSLAISVPEMV FVQIHQTLDGVWHCYADFGGHATIWKLYLRFQLNLLGFLLPLLAMIFFYSRIGCVLVRLR PPGQGRALRMAAALVIVFFMLWFPYNLTLFLHSLLDLHVFGNCEISHRLDYTLQVTESLA FSHCCFTPVLYAFCSHRFRRYLKAFLSVMLRWHQAPGTPSSNHSESSRVTAQEDVVSMND LGERQSEDSLNKGEMGNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, pan (AE-1 / AE-3), CF405L conjugate, 0.1mg/mL
BNC060371-500 1x 500 µL

Cytokeratin, pan (AE-1 / AE-3), CF405L conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS701602 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Btbd7 Mouse Gene Knockout Kit (CRISPR)
KN502300 1 Kit

Btbd7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HLA-DPB1 (NM_002121) Human Over-expression Lysate
LC400773 20 µg

HLA-DPB1 (NM_002121) Human Over-expression Lysate

Sign In for Pricing
View Details
HypoGel® 200 HMBA
SP200110150140.5G 5 g

HypoGel® 200 HMBA

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS619877 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details