Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Chemokine-binding protein 2 (Ccbp2)

This Recombinant Mouse Chemokine-binding protein 2 (Ccbp2) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Chemokine-binding protein 2, C-C chemokine receptor D6, Chemokine-binding protein D6

UniProt

O08707

Expression Region

1-378

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTVASPLPLTTVGSENSSSIYDYDYLDDMTILVCRKDEVLSFGRVFLPVVYSLIFVLGL AGNLLLLVVLLHSAPRRRTMELYLLNLAVSNLLFVVTMPFWAISVAWHWVFGSFLCKVIS TLYSINFYCGIFFITCMSLDKYLEIVHAQPLHRPKAQFRNLLLIVMVWITSLAISVPEMV FVQIHQTLDGVWHCYADFGGHATIWKLYLRFQLNLLGFLLPLLAMIFFYSRIGCVLVRLR PPGQGRALRMAAALVIVFFMLWFPYNLTLFLHSLLDLHVFGNCEISHRLDYTLQVTESLA FSHCCFTPVLYAFCSHRFRRYLKAFLSVMLRWHQAPGTPSSNHSESSRVTAQEDVVSMND LGERQSEDSLNKGEMGNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CFH Antibody Pair Set
E-KAB-0181 50 µL & 100 µg

Human CFH Antibody Pair Set

Sign In for Pricing
View Details
Human Neuraminidase (NEU1) activation kit by CRISPRa
GA103173 1 Kit

Human Neuraminidase (NEU1) activation kit by CRISPRa

Sign In for Pricing
View Details
CARD11 (NM_032415) Human Over-expression Lysate
LC403162 20 µg

CARD11 (NM_032415) Human Over-expression Lysate

Sign In for Pricing
View Details
GPR88 Human Gene Knockout Kit (CRISPR)
KN418133 1 Kit

GPR88 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS701585 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Metaphosphoric Acid Potassium Salt
TRC-M226260-5G 5 g

Metaphosphoric Acid Potassium Salt

Sign In for Pricing
View Details