Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27)

This Recombinant Mouse Probable G-protein coupled receptor 27 (Gpr27) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 27, Super conserved receptor expressed in brain 1

UniProt

O54897

Expression Region

1-379

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANASEPGGGGSGGGAEAAALGLRLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLL LDLCLADGLRALACLPAVMLAARRAAAAAGTPPGALGCKLLAFLAALFCFHAAFLLLGVG VTRYLAIAHHRFYAERLAGWPCAAMLVCAAWALALAAAFPPVLDGGGADDEDAPCALEQR PDGAPGALGFLLLLAAVVGATHLVYLRLLFFIHDRRKMRPARLVPAVSHDWTFHGPGATG QAAANWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEKRLCKMFYAITLLFLLL WGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFRAQFPCC QSPQATQATLPCDLKGIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Prolactin Inducible Protein (PIP) ELISA Kit
YP-W14969-01 48 Tests

Human Prolactin Inducible Protein (PIP) ELISA Kit

Sign In for Pricing
View Details
Human Prolactin Inducible Protein (PIP) ELISA Kit
YP-W14969-02 96 Tests

Human Prolactin Inducible Protein (PIP) ELISA Kit

Sign In for Pricing
View Details
NOMO1 Rabbit pAb, PE-Cy7 conjugated
orb2844799 100 µL

NOMO1 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
IGF2R/M6PR Recombinant Antibody
bsm-60860R 100 µL

IGF2R/M6PR Recombinant Antibody

Sign In for Pricing
View Details
BCL10 Antibody
orb1319249 100 µL

BCL10 Antibody

Sign In for Pricing
View Details
CHRNA9 Antibody
orb2672256-01 50 µL

CHRNA9 Antibody

Sign In for Pricing
View Details