Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Takifugu rubripes 5-hydroxytryptamine receptor 1D (htr1d)

This Recombinant Takifugu rubripes 5-hydroxytryptamine receptor 1D (htr1d) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1D, 5-HT-1D, 5-HT1D, 5HT1D, F1D, Serotonin receptor 1D

UniProt

P79748

Expression Region

1-379

Origin

Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELDNNSLDYFSSNFTDIPSNTTVAHWTEATLLGLQISVSVVLAIVTLATMLSNAFVIAT IFLTRKLHTPANFLIGSLAVTDMLVSILVMPISIVYTVSKTWSLGQIVCDIWLSSDITFC TASILHLCVIALDRYWAITDALEYSKRRTMRRAAVMVAVVWVISISISMPPLFWRQAKAH EELKECMVNTDQISYTLYSTFGAFYVPTVLLIILYGRIYVAARSRIFKTPSYSGKRFTTA QLIQTSAGSSLCSLNSASNQEAHLHSGAGGEGGGSPLFVNSVKVKLADNVLERKRLCAAR ERKATKTLGIILGAFIICWLPFFVVTLVWAICKECSFDPLLFDVFTWLGYLNSLINPVIY TVFNDEFKQAFQKLIKFRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

First Strand cDNA Rat Kidney
CR1003 30 Reactions

First Strand cDNA Rat Kidney

Sign In for Pricing
View Details
Cpox Mouse Gene Knockout Kit (CRISPR)
KN503771 1 Kit

Cpox Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Striatin (STRN) Human Gene Knockout Kit (CRISPR)
KN415098 1 Kit

Striatin (STRN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Anti-LcH Antibody
BAL-1401-2 2 mL

Biotin Conjugated Rabbit Anti-LcH Antibody

Sign In for Pricing
View Details
Sodium Dichromate Dihydrate
TRC-S615250-50G 50 g

Sodium Dichromate Dihydrate

Sign In for Pricing
View Details
PARG Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F6]
TA808712BM 100 µL

PARG Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F6]

Sign In for Pricing
View Details